Gallibacterium anatis: UMN179_01960 Help Entry UMN179_01960      CDS       T01482                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism gan  Gallibacterium anatis Pathway gan02024   Quorum sensing gan03018   RNA degradation Brite KEGG Orthology (KO) [BR:gan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     UMN179_01960  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     UMN179_01960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gan03019]     UMN179_01960    03036 Chromosome and associated proteins [BR:gan03036]     UMN179_01960 Messenger RNA biogenesis [BR:gan03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      UMN179_01960 Chromosome and associated proteins [BR:gan03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     UMN179_01960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AEC17973 UniProt:  F4HE12 LinkDB All DBs Position complement(2116832..2117107) Genome browser AA seq 91 aa AA seqDB search MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARAISHHNHQANAVNQEEDAVVTNEEE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggacaatcattacaagatccttatttaaacgcacttcgtcgtgaacgtatt cctgtttcaatctacctcgtaaacggcattaagttgcaaggtcaaatcgaatcattcgac caatttgttatccttcttaaaaatactgtaagccaaatggtatataaacacgctatttct actgttgtccctgcacgggcaatttctcatcataatcatcaagcaaatgcagtcaatcag gaagaagatgctgttgtaacaaacgaagaagagtaa

DBGET integrated database retrieval system