Glutamicibacter halophytocola: AOZ07_07925 Help Entry AOZ07_07925       CDS       T04229                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gar  Glutamicibacter halophytocola Pathway gar00998   Biosynthesis of various antibiotics gar01100   Metabolic pathways gar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AOZ07_07925    00074 Mycolic acid biosynthesis     AOZ07_07925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AOZ07_07925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALG28917 UniProt:  A0A5B8IIZ3 LinkDB All DBs Position complement(1733669..1733914) Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNSETGLDEADVQLDKSFTEDLDIDSISMMTIVVEAEEKFDVKIPD EEVKNLKTVGDAVSFIASVQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggcgggcctcgccgaaatcgtcaactccgagaccggc ctggacgaagcagacgtgcagctggacaagtccttcaccgaggacctggacatcgactcg atctcgatgatgaccatcgtcgtagaggcagaagagaagttcgacgtaaagattccggac gaggaagtcaagaacctgaagaccgtaggcgacgctgtcagcttcatcgcttcggttcag gcctaa

DBGET integrated database retrieval system