Gracilinanus agilis (agile gracile opossum): 123234585
Help
Entry
123234585 CDS
T07702
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
gas
Gracilinanus agilis (agile gracile opossum)
Pathway
gas03050
Proteasome
gas05010
Alzheimer disease
gas05012
Parkinson disease
gas05014
Amyotrophic lateral sclerosis
gas05016
Huntington disease
gas05017
Spinocerebellar ataxia
gas05020
Prion disease
gas05022
Pathways of neurodegeneration - multiple diseases
gas05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
gas00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
123234585 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
123234585 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
123234585 (PSMD7)
05012 Parkinson disease
123234585 (PSMD7)
05014 Amyotrophic lateral sclerosis
123234585 (PSMD7)
05016 Huntington disease
123234585 (PSMD7)
05017 Spinocerebellar ataxia
123234585 (PSMD7)
05020 Prion disease
123234585 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
123234585 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
gas03051
]
123234585 (PSMD7)
Proteasome [BR:
gas03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
123234585 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
123234585
NCBI-ProteinID:
XP_044516438
LinkDB
All DBs
Position
2:47524772..47536521
Genome browser
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRGYLEKVAMGKLPINHQIIYQLQDVFNLLPDV
NLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKDKDKEKGDAKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtcgtggttcaccccctggtactcctcagtgtggtg
gatcacttcaaccgaataggaaaagttggaaatcaaaaacgtgtggttggtgtgctctta
gggtcatggcagaaaaaagtacttgatgtttccaacagttttgcagtcccttttgatgaa
gatgacaaagatgactcggtctggtttcttgatcatgactatttggaaaatatgtatgga
atgtttaagaaagtcaacgccagagaaagaatagttgggtggtaccatacaggcccaaag
cttcacaagaatgacattgctatcaatgagctcatgaagagatactgtcctaactcagta
ctggtaataattgatgtgaaaccaaaggacctaggactgcccacagaagcatatatttca
gttgaagaagttcatgatgatggaactccaacctccaagacatttgaacatgtgactagt
gaaatcggagcagaggaagcagaagaggttggagtggaacatctacttcgagacatcaaa
gacaccacagttggcaccctttctcagcgtatcacgaatcaggtccatggcttaaaggga
ctgaactccaagcttctggacatcaggggctacctggagaaagtagcaatgggcaagtta
cccatcaaccaccaaataatctaccagctacaggatgtcttcaatttgttgcctgatgtc
aacctgcaagaatttgtcaaggcattttacctgaagaccaatgaccaaatggtggtggta
tacctggcctcactgatccgttcagtagttgccttgcacaacctcatcaacaacaagatt
gccaacagggatgcagagaagaaagaggggcaggaaaaggaggagagcaaaaaggagagg
aaagacgacaaggagaaagataaggataaagaaaaaggagatgctaagaaggaagagaaa
aaggagaaaaaataa
DBGET
integrated database retrieval system