KEGG   Gracilinanus agilis (agile gracile opossum): 123247194
Entry
123247194         CDS       T07702                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
gas  Gracilinanus agilis (agile gracile opossum)
Pathway
gas01521  EGFR tyrosine kinase inhibitor resistance
gas01522  Endocrine resistance
gas04010  MAPK signaling pathway
gas04012  ErbB signaling pathway
gas04014  Ras signaling pathway
gas04015  Rap1 signaling pathway
gas04062  Chemokine signaling pathway
gas04068  FoxO signaling pathway
gas04071  Sphingolipid signaling pathway
gas04072  Phospholipase D signaling pathway
gas04137  Mitophagy - animal
gas04140  Autophagy - animal
gas04150  mTOR signaling pathway
gas04151  PI3K-Akt signaling pathway
gas04210  Apoptosis
gas04211  Longevity regulating pathway
gas04213  Longevity regulating pathway - multiple species
gas04218  Cellular senescence
gas04360  Axon guidance
gas04370  VEGF signaling pathway
gas04371  Apelin signaling pathway
gas04540  Gap junction
gas04550  Signaling pathways regulating pluripotency of stem cells
gas04625  C-type lectin receptor signaling pathway
gas04650  Natural killer cell mediated cytotoxicity
gas04660  T cell receptor signaling pathway
gas04662  B cell receptor signaling pathway
gas04664  Fc epsilon RI signaling pathway
gas04714  Thermogenesis
gas04720  Long-term potentiation
gas04722  Neurotrophin signaling pathway
gas04725  Cholinergic synapse
gas04726  Serotonergic synapse
gas04730  Long-term depression
gas04810  Regulation of actin cytoskeleton
gas04910  Insulin signaling pathway
gas04912  GnRH signaling pathway
gas04915  Estrogen signaling pathway
gas04916  Melanogenesis
gas04917  Prolactin signaling pathway
gas04919  Thyroid hormone signaling pathway
gas04921  Oxytocin signaling pathway
gas04926  Relaxin signaling pathway
gas04929  GnRH secretion
gas04933  AGE-RAGE signaling pathway in diabetic complications
gas04935  Growth hormone synthesis, secretion and action
gas05010  Alzheimer disease
gas05022  Pathways of neurodegeneration - multiple diseases
gas05034  Alcoholism
gas05160  Hepatitis C
gas05161  Hepatitis B
gas05163  Human cytomegalovirus infection
gas05165  Human papillomavirus infection
gas05166  Human T-cell leukemia virus 1 infection
gas05167  Kaposi sarcoma-associated herpesvirus infection
gas05170  Human immunodeficiency virus 1 infection
gas05200  Pathways in cancer
gas05203  Viral carcinogenesis
gas05205  Proteoglycans in cancer
gas05206  MicroRNAs in cancer
gas05207  Chemical carcinogenesis - receptor activation
gas05208  Chemical carcinogenesis - reactive oxygen species
gas05210  Colorectal cancer
gas05211  Renal cell carcinoma
gas05213  Endometrial cancer
gas05214  Glioma
gas05215  Prostate cancer
gas05216  Thyroid cancer
gas05218  Melanoma
gas05219  Bladder cancer
gas05220  Chronic myeloid leukemia
gas05221  Acute myeloid leukemia
gas05223  Non-small cell lung cancer
gas05224  Breast cancer
gas05225  Hepatocellular carcinoma
gas05226  Gastric cancer
gas05230  Central carbon metabolism in cancer
gas05231  Choline metabolism in cancer
gas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
gas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:gas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123247194 (NRAS)
   04012 ErbB signaling pathway
    123247194 (NRAS)
   04014 Ras signaling pathway
    123247194 (NRAS)
   04015 Rap1 signaling pathway
    123247194 (NRAS)
   04370 VEGF signaling pathway
    123247194 (NRAS)
   04371 Apelin signaling pathway
    123247194 (NRAS)
   04068 FoxO signaling pathway
    123247194 (NRAS)
   04072 Phospholipase D signaling pathway
    123247194 (NRAS)
   04071 Sphingolipid signaling pathway
    123247194 (NRAS)
   04151 PI3K-Akt signaling pathway
    123247194 (NRAS)
   04150 mTOR signaling pathway
    123247194 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123247194 (NRAS)
   04137 Mitophagy - animal
    123247194 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    123247194 (NRAS)
   04218 Cellular senescence
    123247194 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    123247194 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    123247194 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123247194 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123247194 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    123247194 (NRAS)
   04660 T cell receptor signaling pathway
    123247194 (NRAS)
   04662 B cell receptor signaling pathway
    123247194 (NRAS)
   04664 Fc epsilon RI signaling pathway
    123247194 (NRAS)
   04062 Chemokine signaling pathway
    123247194 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123247194 (NRAS)
   04929 GnRH secretion
    123247194 (NRAS)
   04912 GnRH signaling pathway
    123247194 (NRAS)
   04915 Estrogen signaling pathway
    123247194 (NRAS)
   04917 Prolactin signaling pathway
    123247194 (NRAS)
   04921 Oxytocin signaling pathway
    123247194 (NRAS)
   04926 Relaxin signaling pathway
    123247194 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    123247194 (NRAS)
   04919 Thyroid hormone signaling pathway
    123247194 (NRAS)
   04916 Melanogenesis
    123247194 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    123247194 (NRAS)
   04726 Serotonergic synapse
    123247194 (NRAS)
   04720 Long-term potentiation
    123247194 (NRAS)
   04730 Long-term depression
    123247194 (NRAS)
   04722 Neurotrophin signaling pathway
    123247194 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    123247194 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    123247194 (NRAS)
   04213 Longevity regulating pathway - multiple species
    123247194 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    123247194 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123247194 (NRAS)
   05206 MicroRNAs in cancer
    123247194 (NRAS)
   05205 Proteoglycans in cancer
    123247194 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    123247194 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    123247194 (NRAS)
   05203 Viral carcinogenesis
    123247194 (NRAS)
   05230 Central carbon metabolism in cancer
    123247194 (NRAS)
   05231 Choline metabolism in cancer
    123247194 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123247194 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123247194 (NRAS)
   05225 Hepatocellular carcinoma
    123247194 (NRAS)
   05226 Gastric cancer
    123247194 (NRAS)
   05214 Glioma
    123247194 (NRAS)
   05216 Thyroid cancer
    123247194 (NRAS)
   05221 Acute myeloid leukemia
    123247194 (NRAS)
   05220 Chronic myeloid leukemia
    123247194 (NRAS)
   05218 Melanoma
    123247194 (NRAS)
   05211 Renal cell carcinoma
    123247194 (NRAS)
   05219 Bladder cancer
    123247194 (NRAS)
   05215 Prostate cancer
    123247194 (NRAS)
   05213 Endometrial cancer
    123247194 (NRAS)
   05224 Breast cancer
    123247194 (NRAS)
   05223 Non-small cell lung cancer
    123247194 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123247194 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    123247194 (NRAS)
   05161 Hepatitis B
    123247194 (NRAS)
   05160 Hepatitis C
    123247194 (NRAS)
   05163 Human cytomegalovirus infection
    123247194 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123247194 (NRAS)
   05165 Human papillomavirus infection
    123247194 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123247194 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    123247194 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    123247194 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123247194 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    123247194 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123247194 (NRAS)
   01522 Endocrine resistance
    123247194 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gas04131]
    123247194 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gas04147]
    123247194 (NRAS)
   04031 GTP-binding proteins [BR:gas04031]
    123247194 (NRAS)
Membrane trafficking [BR:gas04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    123247194 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    123247194 (NRAS)
Exosome [BR:gas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   123247194 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   123247194 (NRAS)
  Exosomal proteins of breast cancer cells
   123247194 (NRAS)
  Exosomal proteins of colorectal cancer cells
   123247194 (NRAS)
GTP-binding proteins [BR:gas04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    123247194 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 123247194
NCBI-ProteinID: XP_044531930
LinkDB
Position
4:complement(465966118..465973061)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CLGLSCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtataaactggtggtggtcggagctggcggtgtggggaaaagcgccttgacc
atccagctcatccagaatcactttgtagacgagtatgatcctacgatagaggactcctat
cgaaagcaagtagttattgatggtgaaacctgtttgttggacatactcgacacagctgga
caggaagagtacagtgctatgagagaccagtatatgaggacaggcgaaggctttctctgt
gtgtttgccatcaacaatagcaaatcatttgcagatataaacctctacagggaacaaatt
aaacgagtgaaagactctgatgatgtgcctatggtgctggtgggaaataagtgtgatttg
ccaacaaggacagttgacacaaaacaggctcatgaactagccaagagctatggaattccc
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgacagtaccgcatgaaaaaactgaacagtagcgacgacgggactcaaggt
tgtctaggtctctcgtgtgcagtcatgtaa

DBGET integrated database retrieval system