KEGG   Gracilinanus agilis (agile gracile opossum): 123255860
Entry
123255860         CDS       T07702                                 
Symbol
ATP5MC2
Name
(RefSeq) ATP synthase F(0) complex subunit C2, mitochondrial
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
gas  Gracilinanus agilis (agile gracile opossum)
Pathway
gas00190  Oxidative phosphorylation
gas01100  Metabolic pathways
gas04714  Thermogenesis
gas05010  Alzheimer disease
gas05012  Parkinson disease
gas05014  Amyotrophic lateral sclerosis
gas05016  Huntington disease
gas05020  Prion disease
gas05022  Pathways of neurodegeneration - multiple diseases
gas05208  Chemical carcinogenesis - reactive oxygen species
gas05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:gas00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    123255860 (ATP5MC2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    123255860 (ATP5MC2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    123255860 (ATP5MC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123255860 (ATP5MC2)
   05012 Parkinson disease
    123255860 (ATP5MC2)
   05014 Amyotrophic lateral sclerosis
    123255860 (ATP5MC2)
   05016 Huntington disease
    123255860 (ATP5MC2)
   05020 Prion disease
    123255860 (ATP5MC2)
   05022 Pathways of neurodegeneration - multiple diseases
    123255860 (ATP5MC2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    123255860 (ATP5MC2)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 123255860
NCBI-ProteinID: XP_044540516
LinkDB
Position
Unknown
AA seq 173 aa
MLRPPRALSPPGPSLTEAPRAALFCFAPHPLRMYACAKFISTPVLVRSSSQLLSRPVSAV
VLRRPEVRTDENLSTLAASGPLTSLIPRCGFQTSAVSRDVDTAAKFIGAGAATVGVAGSG
AGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
NT seq 522 nt   +upstreamnt  +downstreamnt
atgcttcgtcctcccagggcgctgagccccccaggaccctcactaactgaggcccctagg
gcggctctcttctgctttgcccctcaccccctgagaatgtacgcctgcgccaagttcatc
tctacccctgtccttgtgaggagcagctctcagctgctgagtcgaccggtatctgcagtg
gtactgagacggccagaggttcggacagatgagaacctcagcaccttggcagcatccggt
cccctgacttcactcattcccagatgtggattccaaactagcgccgtctcaagggacgtt
gacacagcagccaagttcatcggagctggagctgccactgtgggggtggctggctctgga
gctgggattgggactgtatttggaagtctcatcattggttatgccaggaatccctccctg
aagcagcagctcttctcctacgccatcctgggctttgccctgtctgaggccatggggctc
ttttgcctgatggtggccttcctcatcctcttcgccatgtga

DBGET integrated database retrieval system