Gimesia algae: Pan161_22790 Help Entry Pan161_22790      CDS       T09989                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gax  Gimesia algae Pathway gax00998   Biosynthesis of various antibiotics gax01100   Metabolic pathways gax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pan161_22790 (acpP_1)    00074 Mycolic acid biosynthesis     Pan161_22790 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pan161_22790 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF7080 Ribosomal_L12_N Guanylate_cyc DUF5783 Motif Other DBs NCBI-ProteinID:  QDT90626 UniProt:  A0A517VC95 LinkDB All DBs Position complement(3018406..3018639) Genome browser AA seq 77 aa AA seqDB search MSIEEKVVGIVSEQLGHPKEDITLDSKFIDDLKADSLDIVELVMEFEDEFDVTIPDDDYD KIKTVGDVVGYITEKAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgtcaattgaagaaaaagtggttggtatcgttagcgagcaattaggccaccctaaggaa gatattacgctggacagcaaatttatcgacgacctcaaggccgattctctggacattgta gaactcgtaatggaattcgaagacgagtttgatgtgaccattcctgatgacgactatgac aaaatcaaaactgtcggcgatgtagttggctacatcactgaaaaggcaagctga

DBGET integrated database retrieval system