Gemmatirosa kalamazoonensis: J421_4056 Help Entry J421_4056         CDS       T03025                                  Name (GenBank) Aldehyde Dehydrogenase   KO K00128   aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] Organism gba  Gemmatirosa kalamazoonensis Pathway gba00010   Glycolysis / Gluconeogenesis gba00053   Ascorbate and aldarate metabolism gba00071   Fatty acid degradation gba00280   Valine, leucine and isoleucine degradation gba00310   Lysine degradation gba00330   Arginine and proline metabolism gba00340   Histidine metabolism gba00380   Tryptophan metabolism gba00410   beta-Alanine metabolism gba00561   Glycerolipid metabolism gba00620   Pyruvate metabolism gba00625   Chloroalkane and chloroalkene degradation gba00770   Pantothenate and CoA biosynthesis gba01100   Metabolic pathways gba01110   Biosynthesis of secondary metabolites gba01120   Microbial metabolism in diverse environments gba01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:gba00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     J421_4056    00053 Ascorbate and aldarate metabolism     J421_4056    00620 Pyruvate metabolism     J421_4056   09103 Lipid metabolism    00071 Fatty acid degradation     J421_4056    00561 Glycerolipid metabolism     J421_4056   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     J421_4056    00310 Lysine degradation     J421_4056    00330 Arginine and proline metabolism     J421_4056    00340 Histidine metabolism     J421_4056    00380 Tryptophan metabolism     J421_4056   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     J421_4056   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     J421_4056   09109 Metabolism of terpenoids and polyketides    00903 Limonene degradation     J421_4056   09111 Xenobiotics biodegradation and metabolism    00625 Chloroalkane and chloroalkene degradation     J421_4056 Enzymes [BR:gba01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.1  With NAD+ or NADP+ as acceptor     1.2.1.3  aldehyde dehydrogenase (NAD+)      J421_4056 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Aldedh Motif Other DBs NCBI-ProteinID:  AHG91593 UniProt:  W0RQ01 LinkDB All DBs Position complement(4691835..4692467) Genome browser AA seq 210 aa AA seqDB search MTAFRDAAARFVAERFPRLVETRDYTRVVNAAHWTRLAGYVEEARVRGVEVVEVNPAGER CTIDNRVLPPTLLVDPPEDLAVMQEEIFGPLLPLVPYDALEDAIDYVNARPRPLALYYFD DDGRRVNLVLERTTSGGVTVNDVVYHLGQDNLPFGGVGPSGMGHYHGFDGFERFSKKKGV MLQSRLSALKLVWPPYTARTRALVDRLMRL NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgacggcattccgcgacgccgccgctcgcttcgtcgccgagcgctttccgcggctcgtc gagacacgcgactacacgcgcgtggtgaacgccgcgcactggacgcggctcgccggctac gtcgaggaggcgcgcgtccgcggcgtggaggtcgtcgaggtgaaccccgccggcgagcgg tgcacgatcgacaaccgcgtgctgccgccgacgctgctcgtcgacccgccggaggatctg gcggtcatgcaggaggagatcttcggcccgctgctgccgctcgtgccgtacgacgcgctg gaggacgcgatcgactacgtgaacgcgcgcccgcgtccgctcgccctgtactacttcgac gacgacggccgacgcgtgaacctcgtgctcgagcgcacgacgtccggcggcgtgacggtg aacgacgtcgtgtaccacctcggccaggacaacctcccgttcggcggcgtggggcccagc ggcatgggccactaccacggcttcgacggcttcgagcgcttctccaagaagaagggcgtc atgctgcagtcgagactctccgcgctgaagctcgtgtggccgccgtacacggcgcgcacg cgggcgctcgtggaccgcctgatgaggctctag

DBGET integrated database retrieval system