Candidatus Comchoanobacter bicostacola: MMH89_02790 Help Entry MMH89_02790       CDS       T08376                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gbac  Candidatus Comchoanobacter bicostacola Pathway gbac01100   Metabolic pathways gbac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gbac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MMH89_02790 (acpP)    00074 Mycolic acid biosynthesis     MMH89_02790 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MMH89_02790 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  UTC24150 LinkDB All DBs Position complement(580330..580584) Genome browser AA seq 84 aa AA seqDB search MTQVQDKVCEITAKILGLDLNQVSLDASFQEDLGADSIDVVEVVIAVEDEFGIDISDERA ERVRSVQDIIDCVNEIKEINDEPA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactcaagtgcaagataaagtttgtgaaattacagcaaaaattttaggtttagattta aatcaagtatctcttgatgcatcgtttcaagaggaccttggggcggactcaattgatgtg gttgaggttgtgattgcggttgaagatgagtttgggattgatatttcagatgaacgggcg gagcgagtgcgttccgtacaagatataattgactgtgtcaatgaaatcaaagaaatcaat gatgagccagcctaa

DBGET integrated database retrieval system