KEGG   Granulibacter bethesdensis NIH3.1: GbCGDNIH3_1218
Entry
GbCGDNIH3_1218    CDS       T03155                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
gbc  Granulibacter bethesdensis NIH3.1
Pathway
gbc00770  Pantothenate and CoA biosynthesis
gbc01100  Metabolic pathways
gbc01240  Biosynthesis of cofactors
Module
gbc_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:gbc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    GbCGDNIH3_1218
Enzymes [BR:gbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     GbCGDNIH3_1218
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AHJ63019
UniProt: A0AAN0VFR9
LinkDB
Position
complement(1347912..1348517)
AA seq 201 aa
MMPIQLLRQHLMDRWQIQMTESTQGKMLRTGVYPGTFDPVTNGHLDVITRAARMFDRLVI
GVAANIGKNPVFPLEERVDLVRAETVTLGEKTGTIIEVVPFSSLLIDFARQHGASIIVRG
LRAVSDFDYEVQMAGTNYRLAPDIETVFLMASERHQFISSRFVKEIARLGGDISTFVPPL
TLQRTLARVRTSSVPDPERPV
NT seq 606 nt   +upstreamnt  +downstreamnt
atgatgccgattcagttgctccggcagcacctgatggacaggtggcagattcagatgact
gagtcgacacagggcaagatgctgcgcaccggcgtctatcccggtacgttcgatccggtg
acgaacggccatctggacgtcattacccgtgctgcccggatgtttgaccgtctggtgatc
ggggtggctgccaatatcggcaaaaatccggtttttccgctggaggaaagggtagatctg
gttcgtgccgaaacggttacgctgggggaaaaaaccggaaccatcattgaggtggtgccg
ttttcctcgctcctgattgacttcgcccgccagcatggtgccagtatcattgtccgcggt
ctgcgtgcggtgtcggatttcgattatgaggtacaaatggcgggcactaattatcgcctg
gcaccggatatcgagacagtgtttctgatggcgagtgaacgtcatcaattcatctcctcc
cgcttcgtgaaggaaatcgcgcggctggggggtgatatttccacctttgtgcctcccctg
acattgcagcgtacgcttgcgcgtgtcaggacgtcatcggtccctgacccggaaaggccc
gtctga

DBGET integrated database retrieval system