Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0683 Help Entry GbCGDNIH2_0683    CDS       T03083                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism gbh  Granulibacter bethesdensis CGDNIH2 Brite KEGG Orthology (KO) [BR:gbh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gbh03032]     GbCGDNIH2_0683    03036 Chromosome and associated proteins [BR:gbh03036]     GbCGDNIH2_0683    03400 DNA repair and recombination proteins [BR:gbh03400]     GbCGDNIH2_0683 DNA replication proteins [BR:gbh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GbCGDNIH2_0683 Chromosome and associated proteins [BR:gbh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GbCGDNIH2_0683 DNA repair and recombination proteins [BR:gbh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GbCGDNIH2_0683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding VWA_3 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AHJ67719 UniProt:  A0AAN0VF95 LinkDB All DBs Position 775194..775496 Genome browser AA seq 100 aa AA seqDB search MPTLATNKGILMSKAFIAQVIQDSAELTGVAANRTANDLITAIVKEMKKNGKFTLPSFGT FTVRKTKARKGLNPRTGEQIKVKAGKTVRFKASPNLKKSV NT seq 303 nt NT seq  +upstreamnt  +downstreamnt ttgccaacgcttgcgacaaataaggggattttgatgtctaaggcttttattgcccaggtt attcaggacagcgccgagctgactggggtggcggcaaaccgcacggcgaacgatcttatc acggcgatcgtgaaggaaatgaagaagaacggcaagtttacactaccgagcttcggcacc tttactgtcagaaagaccaaggcgcgcaagggtttgaatccgcggacaggggagcagatc aaggtcaaggctggaaagacagttcgtttcaaggcctctccgaatctgaaaaaatctgtc tga

DBGET integrated database retrieval system