Immundisolibacter cernigliae: PG2T_04865 Help Entry PG2T_04865        CDS       T04454                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism gbi  Immundisolibacter cernigliae Pathway gbi01100   Metabolic pathways gbi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gbi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PG2T_04865    00074 Mycolic acid biosynthesis     PG2T_04865   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PG2T_04865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANX03592 UniProt:  A0A1B1YS45 LinkDB All DBs Position complement(1032370..1032618) Genome browser AA seq 82 aa AA seqDB search MTETELRERLLAILGGIAPEARELDLDPEQSFRDQIDIDSMDFLNFVTAVHKQLGVPIPE LDYPRLASLNGAVHYVLAKLPG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccgaaaccgaactgcgcgagcgcctgctcgccatccttggcggcatcgcgcccgag gcgcgcgagctggacctcgaccccgagcagagctttcgcgaccagatcgacatcgactct atggattttctgaacttcgttactgccgtgcacaaacagctcggcgtgccgattccggaa ctggactacccgcgcctggccagcctgaacggggcggtgcattacgtactggcaaagctg ccgggctga

DBGET integrated database retrieval system