Immundisolibacter cernigliae: PG2T_05720 Help Entry PG2T_05720        CDS       T04454                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism gbi  Immundisolibacter cernigliae Pathway gbi02020   Two-component system gbi02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:gbi00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PG2T_05720  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     PG2T_05720  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:gbi02035]     PG2T_05720 Bacterial motility proteins [BR:gbi02035]  Flagellar system   Flagellar assembly proteins    Others     PG2T_05720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FlgM DUF6052 Motif Other DBs NCBI-ProteinID:  ANX03740 UniProt:  A0A1B1YS86 LinkDB All DBs Position 1200276..1200578 Genome browser AA seq 100 aa AA seqDB search MMEIGPTSATADIHKADAAPARPLPAGSAPAAPQPAADDSVDLTDGARQLQDLQAAVAAT PVVDSVRVAALRDAIANGSYRVDAQAIADGLLAQDRAALG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgatggaaatcgggcccacctcagccaccgcagacattcacaaggccgatgccgcgccc gcccgcccgctgcccgccggcagcgcgcccgcggcaccgcagccggccgccgacgacagc gtcgacctgaccgacggcgcccgccagctgcaggacctgcaggcagcggtcgccgccacg ccggtcgtcgacagcgttcgcgtggcggcgctgcgcgacgcgatcgccaacggcagctac cgggtcgacgcgcaggccatcgccgatggcctgctcgcgcaggatcgcgcggcccttgga taa

DBGET integrated database retrieval system