Citrifermentans bemidjiense: Gbem_0547 Help Entry Gbem_0547         CDS       T00749                                  Symbol acpP-5 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gbm  Citrifermentans bemidjiense Pathway gbm01100   Metabolic pathways gbm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gbm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gbem_0547 (acpP-5)    00074 Mycolic acid biosynthesis     Gbem_0547 (acpP-5)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gbem_0547 (acpP-5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACH37576 UniProt:  B5ECE8 LinkDB All DBs Position complement(659708..659965) Genome browser AA seq 85 aa AA seqDB search MVDFTETVRSFIEKEMMTQAHKGTLSPSDSLIDKGIVDSLGVQRLIAYLEQEFDLQIADT EIVPENFETIGSVVNFINYKLTAKG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggtcgacttcaccgaaacagtcagaagcttcatagaaaaggaaatgatgacccaggca cacaaaggaacgctctctccctccgactccctgatagacaaagggatcgtcgattcgctg ggggtccagcggctgatagcttacctggagcaggaattcgacttgcagattgccgacacc gagatcgttccggagaacttcgaaaccatcggatctgtggtcaacttcatcaattacaag ctgactgccaaggggtga

DBGET integrated database retrieval system