Citrifermentans bemidjiense: Gbem_1373 Help Entry Gbem_1373         CDS       T00749                                  Name (GenBank) FlgM family protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism gbm  Citrifermentans bemidjiense Pathway gbm02020   Two-component system gbm02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:gbm00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Gbem_1373  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Gbem_1373  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:gbm02035]     Gbem_1373 Bacterial motility proteins [BR:gbm02035]  Flagellar system   Flagellar assembly proteins    Others     Gbem_1373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ACH38392 UniProt:  B5EIM7 LinkDB All DBs Position complement(1589182..1589460) Genome browser AA seq 92 aa AA seqDB search MKVSDIAHPAQLQQVEEKESKSPAAKERTAAAPRKGGDVVELSTALDQQSTVQQEQLQAQ RVASIKSQIKAGTYQVDARLVAQKMLSGDSGI NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaagtatcggatatagcacacccggcgcagttgcagcaggtagaggaaaaggaatcg aagagcccagcggccaaggaaaggacggcggcagcgccgcgcaagggaggagatgtggtc gagctctccacggcgctggaccagcagagtaccgtgcagcaggaacagttgcaggcgcag cgggtcgcttcgatcaagtcccagataaaggcgggaacctaccaggtggatgcacggctg gtggcgcagaagatgctctccggcgattccgggatctag

DBGET integrated database retrieval system