Citrifermentans bremense: GEOBRER4_29330 Help Entry GEOBRER4_29330    CDS       T07006                                  Name (GenBank) hypothetical protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism gbn  Citrifermentans bremense Brite KEGG Orthology (KO) [BR:gbn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:gbn03000]     GEOBRER4_29330    03036 Chromosome and associated proteins [BR:gbn03036]     GEOBRER4_29330    03400 DNA repair and recombination proteins [BR:gbn03400]     GEOBRER4_29330 Transcription factors [BR:gbn03000]  Prokaryotic type   Helix-turn-helix    Other families     GEOBRER4_29330 Chromosome and associated proteins [BR:gbn03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GEOBRER4_29330 DNA repair and recombination proteins [BR:gbn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       GEOBRER4_29330 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HTH_28 HTH_23 Phage_NinH Xre-like-HTH Motif Other DBs NCBI-ProteinID:  BCG48183 UniProt:  A0A6S6M378 LinkDB All DBs Position 3389493..3389765 Genome browser AA seq 90 aa AA seqDB search MRASNNNEFAGEHIQLLPEGISLEELEKLIIQLALKKSGGNQTKAAKYLKTSRDTLRYRM KKFGLGENGKEEGRFDGEELEGEQIAPCGA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcgggccagcaacaacaacgagttcgccggagagcacatccagctcctcccggagggg atatccctggaggagctggaaaaactgatcatacagctggccctgaagaaatcgggcggc aaccagaccaaggcggccaagtacctgaagaccagcagggacaccttgcgctaccggatg aagaagttcggcctgggggaaaacggcaaagaggaggggcggtttgatggcgaggagttg gagggggagcagattgccccatgcggagcatga

DBGET integrated database retrieval system