Gottschalkiaceae bacterium SANA: SANA_16860 Help Entry SANA_16860        CDS       T10478                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gbx  Gottschalkiaceae bacterium SANA Pathway gbx00998   Biosynthesis of various antibiotics gbx01100   Metabolic pathways gbx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gbx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SANA_16860 (acpP)    00074 Mycolic acid biosynthesis     SANA_16860 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SANA_16860 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 CatAgl_D2 Motif Other DBs NCBI-ProteinID:  BES65247 LinkDB All DBs Position 1830687..1830917 Genome browser AA seq 76 aa AA seqDB search MHFETVQNIIAENLDIEKEKIQLNSRFKEDLDMDSIELMEVVMACEEEFGVEFPIENADS ITSVQDAVNLVKDIKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcattttgaaaccgttcaaaatattattgcagagaatttggatattgaaaaagagaaa attcaattgaactcacgattcaaagaagaccttgatatggactctatcgaattgatggaa gttgtcatggcttgtgaagaagaatttggtgttgaatttcccattgaaaatgccgattcc atcacaagcgtgcaggatgcggtcaatctagtcaaagatataaagaaatga

DBGET integrated database retrieval system