Gallionella capsiferriformans: Galf_2391 Help Entry Galf_2391         CDS       T01295                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism gca  Gallionella capsiferriformans Pathway gca00190   Oxidative phosphorylation gca01100   Metabolic pathways gca02020   Two-component system Module gca_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:gca00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Galf_2391  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Galf_2391 Enzymes [BR:gca01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Galf_2391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADL56393 UniProt:  D9SJK5 LinkDB All DBs Position complement(2576664..2576798) Genome browser AA seq 44 aa AA seqDB search MWYFAWVLGVSAAVMFAVLNAMWYEAQECAQIRGHDRAGLHSLR NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcttgggttctaggcgtgtctgccgctgtcatgttcgctgtgctcaat gcgatgtggtatgaggcgcaggagtgtgcccagatccgcgggcatgatcgagcaggcctg cactcactgcgttag

DBGET integrated database retrieval system