Gallionella capsiferriformans: Galf_2925
Help
Entry
Galf_2925 CDS
T01295
Name
(GenBank) phosphonate ABC transporter, ATPase subunit
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
gca
Gallionella capsiferriformans
Pathway
gca02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
gca00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Galf_2925
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
gca02000
]
Galf_2925
Enzymes [BR:
gca01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
Galf_2925
Transporters [BR:
gca02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
Galf_2925
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
RsgA_GTPase
AAA_29
AAA_16
AAA_23
SMC_N
AAA_22
AAA_25
nSTAND1
AAA_28
AAA_27
Motif
Other DBs
NCBI-ProteinID:
ADL56917
UniProt:
D9SEM2
LinkDB
All DBs
Position
3139283..3140086
Genome browser
AA seq
267 aa
AA seq
DB search
MIELKNVSVRYGADAIGLHPTSLSFKRGEFNVLLGASGAGKSTLLRCLNMLTRPTTGSIH
VQDVGVVDTAAALRLHRRRTGMIFQQHQLIRRHTALQNVLLGRIGYHTTLRSMFPLPRAE
QHIALECLERVGLLEKATERVDRLSGGQLQRVGIARALAQQPRLMLADEPVASLDPATSR
RVLSQLKHICLEDGITTVVSLHQVDLAREFADRIIAIAHGRVVYDGSPNELSDALLQDIY
DQAPTSGREEIPVPPLPSFTQLAINEE
NT seq
804 nt
NT seq
+upstream
nt +downstream
nt
gtgatcgaactcaaaaatgtatccgtcaggtatggagccgatgcgatcgggctgcatccg
acctcgctgagtttcaagcgcggtgaatttaatgtcctgcttggcgcttcgggcgcgggt
aagtcgacgttgcttcgctgtctcaatatgcttactcgtccgacaacgggttctattcat
gttcaagatgttggggttgtcgacactgctgcagccctcagactacaccggcgtcgtacc
ggcatgatcttccagcagcatcagctaatccggcgacatacggcgctacagaacgtactt
cttggccgtatcggctatcacaccaccctgcgttccatgttcccattgccccgtgctgaa
cagcatatcgcgcttgaatgtctggagcgtgttggtttgctggaaaaggccaccgagcgg
gttgaccgtttgagcggaggtcaactgcagcgtgttggtatcgcgcgtgcattggcgcag
cagccacgtttgatgctggcggacgaacctgttgccagcctagatccggcaacttcgcgt
cgtgtgttgtcgcaactgaagcatatttgccttgaagatggcatcacgacagtggtgagt
cttcatcaagtcgatctggcgcgtgaattcgccgaccggatcattgccatcgcacatggt
cgggtcgtctacgacggctcaccgaacgaactgagtgacgccctgttgcaggatatctac
gatcaggcgccaaccagtggccgagaagaaatacccgtgccccctttaccttcatttacc
caactagccatcaacgaggagtga
DBGET
integrated database retrieval system