KEGG   Geobacillus sp. C56-T3: GC56T3_0122
Entry
GC56T3_0122       CDS       T01245                                 
Name
(GenBank) ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gct00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GC56T3_0122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gct03011]
    GC56T3_0122
Ribosome [BR:gct03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GC56T3_0122
  Bacteria
    GC56T3_0122
  Archaea
    GC56T3_0122
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e DevR
Other DBs
NCBI-ProteinID: ADI25196
LinkDB
Position
137605..137967
AA seq 120 aa
MITKVDRNAVRKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQIIDDTKSSTIVSASTLD
KEFGLDSTNNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHGRVKALADAAREAGLEF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatcacgaaagtggaccgaaacgcggttcggaagaaaagacacgcgcgcatccgcaaa
aaaatcttcggcacggctgaacgtccgcggttgagcgtgttccgttcaaataaacatatt
tacgcgcaaattatcgatgatacaaaatcgtcaacgatcgtcagcgcctcgacgttggac
aaagagtttggcttggattcgacgaacaacattgaggcagcgaaaaaagtcggcgaactt
gtcgccaaacgtgcattggaaaaaggcattaaaaaagtcgtgttcgaccgtggcgggtat
ttatatcacggacgggtaaaagcattggcagacgccgcccgcgaagccggcttggaattc
taa

DBGET integrated database retrieval system