Geobacillus sp. C56-T3: GC56T3_2362 Help Entry GC56T3_2362       CDS       T01245                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gct  Geobacillus sp. C56-T3 Pathway gct01100   Metabolic pathways gct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gct00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GC56T3_2362    00074 Mycolic acid biosynthesis     GC56T3_2362   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GC56T3_2362 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  ADI27331 LinkDB All DBs Position complement(2490710..2490943) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSRL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccgatgtattggaacgtgtaacgaaaatcatcgttgaccggctgggggttgacgaa tcgcaagtgacgctcgaggcgtcgtttaaggacgacctgggcgctgactcgctcgacatc gtcgaactcgtcatggaacttgaagacgaattcaacatggaaatttccgatgaagaggcg gaaaaaatcgtcacagtcggagacgctgtgaactacataaaaagtcgtctgtaa

DBGET integrated database retrieval system