KEGG   Gluconacetobacter diazotrophicus PA1 5 (JGI): Gdia_2052
Entry
Gdia_2052         CDS       T00798                                 
Name
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gdj  Gluconacetobacter diazotrophicus PA1 5 (JGI)
Pathway
gdj00061  Fatty acid biosynthesis
gdj00620  Pyruvate metabolism
gdj00640  Propanoate metabolism
gdj00720  Other carbon fixation pathways
gdj01100  Metabolic pathways
gdj01110  Biosynthesis of secondary metabolites
gdj01120  Microbial metabolism in diverse environments
gdj01200  Carbon metabolism
gdj01212  Fatty acid metabolism
Module
gdj_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gdj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gdia_2052
   00640 Propanoate metabolism
    Gdia_2052
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    Gdia_2052
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Gdia_2052
Enzymes [BR:gdj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Gdia_2052
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Gdia_2052
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_5 LAL_C2 GARS_A
Other DBs
NCBI-ProteinID: ACI51812
LinkDB
Position
complement(2275978..2277321)
AA seq 447 aa
MFSKILIANRGEIALRVLRACRELGIRTVAIHSTADADAMHVRLADEAVCVGPPATRDSY
LNVAAILSAATITGADAIHPGYGFLSENADFAETVEAHGLAFIGPTGHHIRIMGDKITAK
TTMRALGVPLVPGSDGALASLDEARAVAAQVGYPVLIKATAGGGGRGMKVARTPDEIEEA
WSVARTEARAAFGNDEVYLEKYMDRPRHIELQILADTHGNVVHFGERDCSLQRRHQKLLE
EAGSPALTAEQRDGIGAIATAALSKLGYRNAGTLEFLYQDGQFCFIEMNTRLQVEHPVTE
MVCDVDLVREQIRIAAGEPLGYAQSDIRFSGHAIECRINAEDPVTFLPTPGTVTMYHPPG
GLGVRIDSALYAGYRVPPYYDSMIGKLIVHAPTRADAIARMRRALDEFVIEGVKTVIPLH
RQILDDPEFQKGDYTIHWLERFVASRK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgttttccaagatcctcatcgccaatcgcggcgaaatcgccctgcgggtcctgcgcgcg
tgccgcgagctgggaatccgcacggtcgcgatccattccaccgccgacgccgacgccatg
catgtgcgcctggccgacgaagccgtgtgcgtcgggccgccggcgacgcgggattcgtac
ctgaacgtcgccgccatcctgtcggccgcgaccatcaccggcgccgacgcgatccatccg
ggatacggcttcctgtcggaaaacgccgatttcgccgagacggtcgaggcccacggcctg
gccttcatcgggccgaccggacaccatatccggatcatgggcgacaagatcaccgccaag
accaccatgcgcgcgctgggcgtgccgctggtgcccgggtcggacggcgcgctggccagc
ctggacgaggcccgcgcggtggcggcccaggtcggctatccggtgctgatcaaggcgacg
gccggcggcggcgggcgcggcatgaaggtcgcccgcacccccgacgagatcgaggaagcc
tggagcgtcgcgcggaccgaggcccgggccgcgttcggcaatgacgaggtctatctcgaa
aaatacatggaccggccccggcatatcgagctgcagatcctggccgacacccacggcaat
gtcgtgcatttcggcgagcgcgactgttcgctgcagcggcggcaccagaagctgctggaa
gaggccggatcacccgcgctgaccgccgagcagcgcgacgggatcggcgccatcgcgacc
gcggcgctgagcaagctgggataccgcaacgcgggcacgctggaattcctgtaccaggac
ggacagttctgcttcatcgagatgaacacccgcctgcaggtggaacatccggtgaccgag
atggtctgcgacgtcgacctggtgcgcgagcagatccgcatcgcggcgggcgagccgctg
ggctacgcccagtcggacatccgcttcagcggccatgccatcgaatgccgcatcaacgcc
gaggacccggtgaccttcctgcccacccccggcacggtgacgatgtaccacccgcccggc
ggcctgggcgtgcgcatcgacagcgcgctgtatgccggctatcgcgtgccgccctattac
gacagcatgatcggcaagctgatcgtccatgcccccacccgcgccgacgccatcgcccgg
atgcgccgcgcgctggatgaattcgtcatcgaaggcgtgaagacggtcatcccgctgcat
cgccagatcctggacgatccggaattccagaagggcgattacaccatccactggctggaa
cgcttcgtcgcgtcgcgcaagtag

DBGET integrated database retrieval system