Geobacillus sp. 12AMOR1: GARCT_01199 Help Entry GARCT_01199       CDS       T03966                                  Symbol acpA Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gea  Geobacillus sp. 12AMOR1 Pathway gea01100   Metabolic pathways gea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GARCT_01199 (acpA)    00074 Mycolic acid biosynthesis     GARCT_01199 (acpA)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GARCT_01199 (acpA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  AKM18493 LinkDB All DBs Position 1178161..1178394 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtattggaacgtgtcacgaaaatcatcgtcgaccggctcggggttgacgaa tcgcaagtgacgctcgaggcgtcgttcaaagacgatttgggtgctgactcgctcgacatc gtcgaattggtcatggagctcgaagacgaattcaacatggaaatttccgacgaagaagcg gaaaaaattgtcacagtcggagatgctgtgaactacataaaaagccatctgtaa

DBGET integrated database retrieval system