KEGG   Geobacillus sp. 12AMOR1: GARCT_02997
Entry
GARCT_02997       CDS       T03966                                 
Symbol
thrC_2
Name
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gea  Geobacillus sp. 12AMOR1
Pathway
gea00260  Glycine, serine and threonine metabolism
gea00750  Vitamin B6 metabolism
gea01100  Metabolic pathways
gea01110  Biosynthesis of secondary metabolites
gea01120  Microbial metabolism in diverse environments
gea01230  Biosynthesis of amino acids
Module
gea_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gea00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GARCT_02997 (thrC_2)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GARCT_02997 (thrC_2)
Enzymes [BR:gea01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GARCT_02997 (thrC_2)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: AKM20226
LinkDB
Position
complement(2908031..2909092)
AA seq 353 aa
MAWNGLLDAYGEFLPLTAATPRLSLCEGNTPLIPLPRLSEELGITLYVKVEGANPTGSFK
DRGMVMAVAKAKEEGSHTIICASTGNTSASAAAYAARAGMRCLVVVPNGKIALGKLAQAA
MYGAEIFAIDGNFDEALKMVRRLSETAPITLVNSVNPHRIEGQKTAAFEVCDQLGRAPDV
LAIPVGNAGNITAYWKGFKEYHEAKGTGLPQMRGFEAEGAAAIVRNRVIEQPETVATAIR
IGNPASWEKAVEAANESRGKIDEVSDAEILAAYKRLARTEGIFAEPASCAAIAGVIKQRE
RNEIERGSLVVAVLTGNGLKDPAIALETAAIEPVVLPNDERAVLERLQGVVRT
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcatggaacggcctgcttgacgcctatggcgagtttttgccgctcacggcggcgacg
ccgaggctgtcactttgcgaagggaacacgccgctcattccgctgccgcgtctgtcggaa
gagcttgggatcaccttgtatgtcaaggttgaaggggcgaacccgaccggttcgtttaaa
gaccgcggcatggtgatggcggtggcgaaagcgaaagaggaaggaagccatacgatcatt
tgcgcgtcaactggcaacacgtcggcgtcggcggccgcctatgcggcgcgcgccggcatg
cgttgcctcgtcgttgtgccgaacgggaaaatcgcgcttggcaaactggcgcaagcggcg
atgtacggcgcggagattttcgcgattgacggcaactttgacgaggcgctgaaaatggtg
cgccgcctgagcgaaacggcgccgattacgctcgtcaactcggtcaatccgcaccggatc
gaagggcaaaaaacggcggcgttcgaagtgtgcgaccagcttgggcgcgccccggacgtg
ctcgccattccggtcggcaacgccggcaacatcaccgcctattggaaagggtttaaggag
taccatgaagcgaaaggaacgggcttgccgcaaatgcgcggctttgaagcggaaggagcg
gcggcgatcgtccgcaaccgggtgattgaacagccggagacggtggcgacggcgatccgc
atcggcaatccggcgagctgggaaaaagcggtcgaggccgccaacgaatcgcgcgggaaa
attgatgaggtgagcgacgcagaaattttggccgcctacaagcggctcgcccggacggaa
ggcatttttgccgagccggcatcatgcgcggccatcgccggggtcatcaaacagcgcgaa
cggaacgaaatcgaacgcggcagcctcgtcgtcgcggttctcactggcaacggattgaaa
gacccggccatcgccttggagacggcggcgattgagccggtcgtgctgccgaatgatgaa
cgagctgtcttggagcgtttgcaaggggttgtccgcacatga

DBGET integrated database retrieval system