Geobacillus sp. 12AMOR1: GARCT_03435 Help Entry GARCT_03435       CDS       T03966                                  Symbol qoxD Name (GenBank) Quinol oxidase subunit 4   KO K02829   cytochrome aa3-600 menaquinol oxidase subunit IV [EC:7.1.1.5] Organism gea  Geobacillus sp. 12AMOR1 Pathway gea00190   Oxidative phosphorylation gea01100   Metabolic pathways Module gea_M00416   Cytochrome aa3-600 menaquinol oxidase Brite KEGG Orthology (KO) [BR:gea00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GARCT_03435 (qoxD) Enzymes [BR:gea01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.5  menaquinol oxidase (H+-transporting)      GARCT_03435 (qoxD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  COX4_pro Polysacc_synt DUF3290 OB_DEPS-1_3rd TM250 Motif Other DBs NCBI-ProteinID:  AKM20660 LinkDB All DBs Position complement(3361882..3362181) Genome browser AA seq 99 aa AA seqDB search MGANGHHESFPWKHIIGFLLSLVLTFAALWVALSSGLPLKAVIVIIVLFAIIQASLQLFL FMHVNESDSGKVQTFNMVYSFFIAVVVVAGSIWVMQFVL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgggggctaacggccatcatgaatcatttccgtggaaacatatcattgggtttttgttg tcgctcgtcttgacgtttgcggctctttgggtggcgctctcgtctgggctgccgcttaaa gccgtgatcgtcatcatcgtcttgttcgcgatcatccaagcgagcttgcagctgtttcta ttcatgcacgtcaacgaaagcgacagcggcaaagtgcaaacgttcaacatggtatacagc ttctttattgctgttgtcgttgtcgccggttcgatttgggtgatgcagtttgtgttgtaa

DBGET integrated database retrieval system