Geobacter sp. M18: GM18_3730
Help
Entry
GM18_3730 CDS
T01421
Name
(GenBank) response regulator receiver protein
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
geb
Geobacter sp. M18
Pathway
geb02020
Two-component system
geb02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
geb00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
GM18_3730
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
GM18_3730
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
geb02022
]
GM18_3730
02035 Bacterial motility proteins [BR:
geb02035
]
GM18_3730
Two-component system [BR:
geb02022
]
CheA family
CheA-CheYBV (chemotaxis)
GM18_3730
Bacterial motility proteins [BR:
geb02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
GM18_3730
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
CoA_binding_2
Nitro_FeMo-Co
Motif
Other DBs
NCBI-ProteinID:
ADW15157
LinkDB
All DBs
Position
4368307..4368672
Genome browser
AA seq
121 aa
AA seq
DB search
MALKVMIVDDSLFMRKMLRDILTEEGYEIADEASDGVEAVAKYKECLPDLVTLDIVMPNK
TGIEALQEIMAYDAGARVVMCSAIGQEALTTAATQAGAKAFILKPFNPELVTRVLREVAQ
G
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atggccttgaaggtcatgatagtagacgactcgctcttcatgaggaaaatgctgcgcgac
atcctcaccgaggaggggtacgaaatagccgacgaggcgtccgacggcgtcgaagccgtc
gccaagtacaaggagtgcctccccgacctggtcaccctggacatcgtgatgccgaacaag
accggcatcgaggcgctgcaggagatcatggcctacgacgccggcgcgcgcgtggtgatg
tgctccgccatcggccaggaggcgctcaccaccgctgcgacccaggcgggcgccaaggcc
tttatcctgaagccgttcaacccggagctggtaacccgggtgctcagggaagtggcccag
gggtaa
DBGET
integrated database retrieval system