KEGG   Geobacter sp. FeAm09: FO488_02975
Entry
FO488_02975       CDS       T07988                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
gef  Geobacter sp. FeAm09
Pathway
gef02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gef00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FO488_02975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gef02000]
    FO488_02975
Enzymes [BR:gef01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     FO488_02975
Transporters [BR:gef02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    FO488_02975
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 DEAD AAA_16 AAA_24 AAA_30 nSTAND3 ABC_ATPase AAA_29 RsgA_GTPase Zeta_toxin nSTAND1 Cytidylate_kin AAA_33 AAA_28
Other DBs
NCBI-ProteinID: QEM67224
LinkDB
Position
636075..637826
AA seq 583 aa
MKPTLLRTLGFFKPYWGLLLLSALCSAVVGGMDGAFAYLVEPVLKKIFAGKDTGIFLLVP
IGIIALFLVRGVARFTYDTAIKLAGQKAIQDIRNTLYASTIRQDMAFFNRQATGELMSRM
TNDISQMQEGIGQVVSGLFRDLISAVSLLGVIFYRNWTLAIISFVVIPATAYPAQLIGKK
IKNASGRSLNVMGGLTATLQETFSGVKVIKAFGLENQIISRFHATNLEFFHQIRRFIKYE
SLAMPVSEAIISFGVAGVIYFGGSQVMSGHMTASEFFSFIAAMVMVFNPIKKLQSSYNVV
QRSAGAAERVFNLLDEHRAIVDRPGALDLGRSAGRVEFRNVSFSYGGEPVLQDISLVAES
NRMIALVGPSGGGKSTLAALLPRFYDVSEGAILIDGRDIRDVTVASLVSQIALVDQETTL
FNESIADNIRYGKPGAPLEEVMAAAKAAFAHDFILELPDGYDTSIGDRGLRLSGGQRQRI
CIARALLKNAPILILDEATSALDTESEQMVQKALDNLMVNRTTFVIAHRLSTILHADTII
VLEKGRIVERGSHEDLLKNSSLYSRLHALQFSDRTTGDPSAES
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgaaaccaaccctgttacgcaccctcggatttttcaaaccctactggggcctgctgctc
ctttccgcactctgctcggcggtcgtgggcggcatggacggcgctttcgcctatctggtg
gaaccggtcctgaagaagatctttgccggcaaggataccggcatctttctgctcgtgccg
atcgggatcatcgccctgttcctggtccggggggttgcccgctttacctacgatacggcc
ataaagctggccggccagaaggcgatccaggatatccgcaataccctgtatgccagcacg
attcgccaggatatggcctttttcaaccgccaggccaccggcgagctcatgtcgcgcatg
accaacgatatctcccagatgcaggaggggatcggccaggtcgtgagcgggctgttccgc
gacctgatctccgccgtgtcgcttctgggggtcatcttttatcgcaactggacactggcc
atcatctccttcgtggtgatcccggccacggcctatcccgcccagttgatcggcaagaag
atcaagaatgcctccgggcgcagcctcaacgtcatgggggggctgaccgccacccttcag
gaaaccttttccggcgtcaaggtcatcaaggcttttggtctggaaaaccagattatcagc
cgtttccacgcgaccaacctggagtttttccatcagatccgccgcttcatcaaatacgaa
tccctggccatgccggtttccgaggccatcatctcctttggggtggccggcgtgatctat
ttcggcggcagccaggtcatgtccgggcacatgaccgcctcggaattcttctcgttcatc
gccgccatggtcatggtcttcaacccgatcaagaagctgcaaagctcctacaacgtcgtc
cagcgctctgccggtgcggcggagcgcgtcttcaacctcctggacgaacaccgggccatc
gtcgatcgccccggcgcgcttgacctcggccgttccgccggccgagtggagtttcgcaac
gtatccttcagttacggcggcgaaccggtccttcaggacatctccctggtcgccgaaagc
aaccggatgatcgccctggtggggccctcgggcggcggtaaatcgaccctggcggccctg
ctcccccgcttctatgacgtaagcgaaggcgccatcctcatcgacggccgcgacattcgc
gacgtgaccgttgcctcgctcgtctcccagatcgccctggtggaccaggaaacgaccctg
ttcaacgaaagcatcgccgacaatatccgctacgggaagccgggagctcccctggaagag
gtgatggcggcagccaaggccgcctttgcccatgacttcatcctggaattgcccgacggg
tacgataccagcatcggcgaccggggactgcgcctgtccggcgggcaacgccagcgcatc
tgcatcgcgcgggcgcttctcaagaatgcgccgatcctgatactggacgaggccaccagc
gccctggacacggagagcgagcagatggtgcaaaaggccctggataacctgatggtcaac
cgcaccaccttcgtcattgcccaccggctctccaccatactgcacgccgataccatcatc
gtcctggaaaaggggcggattgtggaacgcggctcccacgaagacctgctgaaaaacagt
agtctctacagccggctgcacgccctgcaattcagcgaccgcaccaccggcgaccccagc
gccgagtcatga

DBGET integrated database retrieval system