Geobacter sp. FeAm09: FO488_08320 Help Entry FO488_08320       CDS       T07988                                  Name (GenBank) cupin domain-containing protein   KO K01809   mannose-6-phosphate isomerase [EC:5.3.1.8] Organism gef  Geobacter sp. FeAm09 Pathway gef00051   Fructose and mannose metabolism gef00520   Amino sugar and nucleotide sugar metabolism gef00541   O-Antigen nucleotide sugar biosynthesis gef01100   Metabolic pathways gef01110   Biosynthesis of secondary metabolites gef01240   Biosynthesis of cofactors gef01250   Biosynthesis of nucleotide sugars Brite KEGG Orthology (KO) [BR:gef00001]  09100 Metabolism   09101 Carbohydrate metabolism    00051 Fructose and mannose metabolism     FO488_08320    00520 Amino sugar and nucleotide sugar metabolism     FO488_08320   09107 Glycan biosynthesis and metabolism    00541 O-Antigen nucleotide sugar biosynthesis     FO488_08320 Enzymes [BR:gef01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.8  mannose-6-phosphate isomerase      FO488_08320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MannoseP_isomer Cupin_2 Motif Other DBs NCBI-ProteinID:  QEM68165 UniProt:  A0A5C1MDN7 LinkDB All DBs Position 1758202..1758567 Genome browser AA seq 121 aa AA seqDB search MFMERGERPWGSYVVLDENTSYKIKRIEVKPGERLSLQKHHHRSEHWIVVSGIAKVTCGD DVLFVNVNESTFIPIGKNHRLENPGKIPLVVIEVQSGEYLGEDDIVRFDDDYNRCSVPDA S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgttcatggaacggggagagcgcccttggggttcttacgtcgtattggacgagaacacc agctacaagatcaagcgcatcgaggtcaagccgggagagcggctgtcgttgcagaagcac catcaccgcagcgagcactggatcgtcgtgtccggcattgccaaggtcacctgcggcgac gacgtgctttttgtcaatgtcaatgaatccacctttatccccatcgggaagaaccaccgc ctggaaaaccccggaaagatccccttggtcgtcatcgaggtgcagagcggcgagtacctg ggtgaagacgatatcgtccgtttcgacgatgattacaatcgttgttctgtgcccgatgcg tcttaa

DBGET integrated database retrieval system