Geobacter sp. FeAm09: FO488_08320 Help Entry FO488_08320       CDS       T07988                                  Name (GenBank) cupin domain-containing protein   KO K01809   mannose-6-phosphate isomerase [EC:5.3.1.8] Organism gef  Geobacter sp. FeAm09 Pathway gef00051   Fructose and mannose metabolism gef00520   Amino sugar and nucleotide sugar metabolism gef01100   Metabolic pathways gef01110   Biosynthesis of secondary metabolites gef01240   Biosynthesis of cofactors gef01250   Biosynthesis of nucleotide sugars Module gef_M01000   GDP-Man biosynthesis, Fru-6P => GDP-Man Brite KEGG Orthology (KO) [BR:gef00001]  09100 Metabolism   09101 Carbohydrate metabolism    00051 Fructose and mannose metabolism     FO488_08320   09107 Glycan biosynthesis and metabolism    00520 Amino sugar and nucleotide sugar metabolism     FO488_08320 Enzymes [BR:gef01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.8  mannose-6-phosphate isomerase      FO488_08320 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MannoseP_isomer Cupin_2 Motif Other DBs NCBI-ProteinID:  QEM68165 LinkDB All DBs Position 1758202..1758567 Genome browser AA seq 121 aa AA seqDB search MFMERGERPWGSYVVLDENTSYKIKRIEVKPGERLSLQKHHHRSEHWIVVSGIAKVTCGD DVLFVNVNESTFIPIGKNHRLENPGKIPLVVIEVQSGEYLGEDDIVRFDDDYNRCSVPDA S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgttcatggaacggggagagcgcccttggggttcttacgtcgtattggacgagaacacc agctacaagatcaagcgcatcgaggtcaagccgggagagcggctgtcgttgcagaagcac catcaccgcagcgagcactggatcgtcgtgtccggcattgccaaggtcacctgcggcgac gacgtgctttttgtcaatgtcaatgaatccacctttatccccatcgggaagaaccaccgc ctggaaaaccccggaaagatccccttggtcgtcatcgaggtgcagagcggcgagtacctg ggtgaagacgatatcgtccgtttcgacgatgattacaatcgttgttctgtgcccgatgcg tcttaa

DBGET integrated database retrieval system