Geobacter sp. FeAm09: FO488_17195 Help Entry FO488_17195       CDS       T07988                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism gef  Geobacter sp. FeAm09 Brite KEGG Orthology (KO) [BR:gef00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gef03036]     FO488_17195 Chromosome and associated proteins [BR:gef03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     FO488_17195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA HALZ XRCC4_CC DivIC bZIP_1 FAZ1_C PRKG1_interact DUF7491 Taxilin Motif Other DBs NCBI-ProteinID:  QEM69716 UniProt:  A0A5C1MFE3 LinkDB All DBs Position complement(3645965..3646141) Genome browser AA seq 58 aa AA seqDB search MDQELFAALEKKVDDLLDKYSGLKADNARLAEENGRLLAEREGLKSRVDAILGKLEGI NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggatcaggaactgtttgctgcgctggagaaaaaggtcgacgacctgcttgacaagtat tcgggcctgaaggccgacaacgcccggctggctgaagaaaacgggcgcctcctggcggag cgcgaaggcctcaagtcgcgcgtcgatgccattctcggcaagctcgaagggatttga

DBGET integrated database retrieval system