Gemmobacter aquarius: HYN69_02330 Help Entry HYN69_02330       CDS       T05407                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism geh  Gemmobacter aquarius Pathway geh00400   Phenylalanine, tyrosine and tryptophan biosynthesis geh01100   Metabolic pathways geh01110   Biosynthesis of secondary metabolites geh01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:geh00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     HYN69_02330 Enzymes [BR:geh01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      HYN69_02330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  AWB47500 UniProt:  A0A2S0UIE1 LinkDB All DBs Position 481163..481459 Genome browser AA seq 98 aa AA seqDB search MTDATQRAAELLRDHRDSIDRLDAILVYTLAERFKRTQAVGRLKAEHALPPSDPAREERQ IARLERLAAEADLDAEFAKKFLTFIIGEVIRHHEKLQK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt ttgaccgacgccacgcagcgcgcagccgaactgttgcgcgaccaccgcgacagcatcgac cggctggatgcgatccttgtctatacgcttgccgagcgtttcaagcgcacgcaggcggtc gggcggctgaaggcagaacatgccctgccccccagcgaccccgcgcgcgaggaacgccag atcgcgcggctggaacggctggcggcggaagccgacctcgacgctgaattcgccaagaaa ttcctgaccttcatcatcggcgaagtcatcaggcatcacgagaaactgcagaaatga

DBGET integrated database retrieval system