Paragemmobacter aquarius: HYN69_17090 Help Entry HYN69_17090       CDS       T05407                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism geh  Paragemmobacter aquarius Brite KEGG Orthology (KO) [BR:geh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:geh03032]     HYN69_17090    03036 Chromosome and associated proteins [BR:geh03036]     HYN69_17090    03400 DNA repair and recombination proteins [BR:geh03400]     HYN69_17090 DNA replication proteins [BR:geh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HYN69_17090 Chromosome and associated proteins [BR:geh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HYN69_17090 DNA repair and recombination proteins [BR:geh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HYN69_17090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG SasG_E HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AWB49989 UniProt:  A0A2S0UQ89 LinkDB All DBs Position 3530537..3530824 Genome browser AA seq 95 aa AA seqDB search MQKPMTKTQLVAALAEEMGSDKKLAGAALDAIAAVVSREVAAGGAVTLPGLGKIVCRARP ERLVRNPATGETVPKPADKQVKFSIAKALKDSVNA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcagaaaccgatgaccaagacgcagcttgttgccgctctggccgaagaaatgggttcg gacaagaaactggccggtgctgccctcgacgccatcgcagccgtcgtgtcgcgtgaagtc gcagctggcggtgccgtcacgctgccgggtctgggcaaaatcgtttgccgcgcccgcccc gagcgtctggttcgcaaccctgcgaccggcgagaccgtgccaaagcctgccgacaagcaa gtcaagttctcgatcgccaaagcactgaaagacagcgtcaacgcctga

DBGET integrated database retrieval system