KEGG   Geitlerinema sp. PCC 7407: GEI7407_1768
Entry
GEI7407_1768      CDS       T02366                                 
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
gei  Geitlerinema sp. PCC 7407
Brite
KEGG Orthology (KO) [BR:gei00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    GEI7407_1768
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: AFY66255
LinkDB
Position
complement(2145118..2145426)
AA seq 102 aa
MATRLSAASPVKAPERSSQTTAKTYPNYKVIVLNDDFNTFQHVAECLLKYIPFMTGDRAW
DLTLQVHNEGQAVVWVGPQEQAELYHMQLRRSGLTMAPLESA
NT seq 309 nt   +upstreamnt  +downstreamnt
atggctacgcgattgtcagccgcctctccggtcaaggcaccggagcgctcgagccaaacc
actgccaagacctaccccaactacaaggtcattgtgctgaatgatgacttcaacaccttt
cagcacgtggctgagtgcctgttgaagtacattccctttatgacgggcgatcgcgcttgg
gatctcacgcttcaggtgcacaacgaaggccaagcagtcgtgtgggtcgggcctcaagag
caagcggagctctatcatatgcagcttcggcgatcgggcttgacgatggctcctctggag
tcggcctag

DBGET integrated database retrieval system