Geitlerinema sp. PCC 7407: GEI7407_2420
Help
Entry
GEI7407_2420 CDS
T02366
Name
(GenBank) Hemolysin-type calcium-binding region
Organism
gei
Geitlerinema sp. PCC 7407
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HemolysinCabind
Motif
Other DBs
NCBI-ProteinID:
AFY66895
LinkDB
All DBs
Position
2964992..2966083
Genome browser
AA seq
363 aa
AA seq
DB search
MALVRGTFSADLISLTSALASTIDADIIYAGEGNDTVFGAGGDDFIKGDSGNDELRGEEG
NDQIFGDRGLDTIFGGNGDDLVDGGSDADLLFGDAGLDTLLGGSGNDTLLGGSGNDQLLG
SIGNDVSVGETGDDELIDTSGNNTLDGGLGNDSLTAGGGIDVLVGDGVYIPGTTLFQGGN
DSLFGGNGNDSLYGGYVVINATTGLPQSFLAASGNDTLDGSGGNDLVDGQDGTDVLIGGS
GNDTVVGGRGADTVQGAGATGDFEIDLLYGDVPGSTTGAGADVFVLGNSTTVFYDAAGTG
DFALIVDFQAGSDKIQLNGSNMMAYGFGISGTETQIFYNGDLIGRVLNITPTNLLNSGSI
VFA
NT seq
1092 nt
NT seq
+upstream
nt +downstream
nt
atggctttagtcagaggtacttttagcgcagacttaatctctttaaccagtgcattggct
tccacaatagatgccgatattatctacgcaggggaaggcaatgatacggtttttggtgct
ggcggcgacgactttattaaaggcgacagcggtaacgatgagctgcgcggagaagaaggc
aatgaccagatctttggcgatcgcggcctagacacgatctttggcgggaacggcgacgac
ctcgtcgacggcggcagcgatgcggacttgcttttcggggacgctggtcttgacacactc
ctaggcggttctggcaatgacacgcttctgggcggctccggcaatgatcaactcctcggc
agcatcggcaacgatgtctctgtcggcgaaactggggatgatgagctgatcgacaccagc
ggcaacaacacccttgacggcggcctaggaaatgacagcttgaccgcaggcggcggcatc
gacgtccttgtcggcgacggcgtctacatccccggcaccacattgtttcagggtggtaac
gacagtctttttggcggcaatggcaacgacagcctatacggcggctatgttgtcattaac
gccacgactggcttgcctcagagctttttggcagcgagcggtaacgacacccttgatggc
agcggcggcaacgatctggtggacggccaagacggcaccgacgttttgatcggcggcagc
ggcaatgacacagttgtggggggacgaggagccgatactgtccaaggagccggggctaca
ggggactttgaaattgatcttctctacggggatgtgccgggttcgaccactggagcgggt
gctgatgtcttcgtgctgggcaacagcacgacggttttctacgatgcagccggaaccggg
gattttgcgctgattgtggattttcaggctggaagcgacaagattcagctcaacggcagc
aatatgatggcctacgggtttggcatcagcggcacagaaacacaaatcttctacaacggc
gatttgattggtcgcgttttgaacatcacgcccactaatctactgaattctggatctatc
gtgtttgcttag
DBGET
integrated database retrieval system