Geobacillus sp. JS12: A0V43_03095 Help Entry A0V43_03095       CDS       T04412                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gej  Geobacillus sp. JS12 Pathway gej01100   Metabolic pathways gej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gej00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0V43_03095    00074 Mycolic acid biosynthesis     A0V43_03095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0V43_03095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  AMQ20119 UniProt:  A0A142CZB7 LinkDB All DBs Position 608225..608458 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSRL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccgatgtattggaacgtgtaacgaaaatcatcgttgaccggctgggggttgacgaa tcgcaagtgacgctcgaggcgtcgtttaaggacgacctgggcgctgactcgctcgacatc gtcgaactcgtcatggaacttgaagacgaattcaacatggaaatttccgatgaagaggcg gaaaaaatcgtcacagtcggagacgctgtgaactacataaaaagtcgcctgtaa

DBGET integrated database retrieval system