Geobacillus sp. JS12: A0V43_14495 Help Entry A0V43_14495       CDS       T04412                                  Name (GenBank) ATP synthase F0F1 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism gej  Geobacillus sp. JS12 Pathway gej00190   Oxidative phosphorylation gej01100   Metabolic pathways Module gej_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:gej00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A0V43_14495  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:gej00194]     A0V43_14495 Photosynthesis proteins [BR:gej00194]  Photosystem and electron transport system   F-type ATPase [OT]    A0V43_14495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AMQ21883 UniProt:  A0A142D4D1 LinkDB All DBs Position complement(2959928..2960146) Genome browser AA seq 72 aa AA seqDB search MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPI IGVVFSFIYLGR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagtttgggtgtacttgcagctgcgattgcggtaggtttgggggcgttaggcgccggc atcggcaacgggttgatcgtcagccgtaccattgaagggattgctcgtcaaccagaattg cgtccggttttgcaaacgacgatgttcatcggggttgcgttggttgaggcgcttccgatc atcggtgtcgtcttctcgttcatttacttaggtcgataa

DBGET integrated database retrieval system