Gelria sp. Kuro-4: kuro4_06700 Help Entry kuro4_06700       CDS       T07432                                  Name (GenBank) NrdH-redoxin   KO K03676   glutaredoxin 3 Organism gek  Gelria sp. Kuro-4 Brite KEGG Orthology (KO) [BR:gek00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gek03110]     kuro4_06700 Chaperones and folding catalysts [BR:gek03110]  Protein folding catalysts   Protein disulfide isomerase    kuro4_06700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_3 Thioredoxin_4 GST_N_2 Glrx-like Thioredoxin_2 GST_N Zn_ribbon_ISL3 SNURF CBS Motif Other DBs NCBI-ProteinID:  BCV23897 LinkDB All DBs Position complement(639351..639587) Genome browser AA seq 78 aa AA seqDB search MSVTVYSTPTCPYCRAAKRYLAERNIPFTDVDVSRDYAAAMEMIRKSGQQGVPVLDINGE IIIGFDRPRIDAALAAGY NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagtgactgtttacagcacgccgacctgcccgtactgccgggccgccaagcgctac ctcgccgagcgcaacattccctttacggacgtcgatgtcagccgcgattacgccgccgcc atggagatgatccgcaaatccggccagcagggcgtaccggtgctggacatcaacggggag atcatcatcggtttcgaccggccccgcatcgatgccgccctggccgccgggtactaa

DBGET integrated database retrieval system