Gelria sp. Kuro-4: kuro4_23570 Help Entry kuro4_23570       CDS       T07432                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism gek  Gelria sp. Kuro-4 Pathway gek00020   Citrate cycle (TCA cycle) gek01100   Metabolic pathways gek01110   Biosynthesis of secondary metabolites gek01120   Microbial metabolism in diverse environments gek01200   Carbon metabolism gek01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:gek00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     kuro4_23570 Enzymes [BR:gek01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      kuro4_23570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_9 Fer4_7 Fer4_21 Fer4_6 Fer4_16 Fer4_4 Fer4_17 Fer4_3 Fer4_22 Fer4_8 Fer4_13 ETF_QO Motif Other DBs NCBI-ProteinID:  BCV25584 UniProt:  A0A9C7EJX6 LinkDB All DBs Position complement(2373577..2373801) Genome browser AA seq 74 aa AA seqDB search MPHGKVAKITINAKWCKGCGICVKFCPSQVLKLGLQKKPEVTNLEQCLDCHLCELRCPDL AIAVLEEEQEVAAS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgccgcacggcaaggtagccaagatcaccatcaacgctaagtggtgtaagggttgcggg atttgcgtcaagttctgcccgtcccaagttctcaagttggggctgcagaaaaagcctgag gtaaccaacctggagcagtgcctggactgccacctgtgtgagctgcggtgtccggatcta gccattgccgttttagaggaggaacaggaagttgctgcaagttaa

DBGET integrated database retrieval system