Geobacillus sp. LC300: IB49_11595 Help Entry IB49_11595        CDS       T04018                                  Name (GenBank) chaperonin   KO K04078   chaperonin GroES Organism gel  Geobacillus sp. LC300 Brite KEGG Orthology (KO) [BR:gel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gel03110]     IB49_11595    03029 Mitochondrial biogenesis [BR:gel03029]     IB49_11595 Chaperones and folding catalysts [BR:gel03110]  Heat shock proteins   HSP10    IB49_11595 Mitochondrial biogenesis [BR:gel03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     IB49_11595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Fe-ADH_2 Motif Other DBs NCBI-ProteinID:  AKU26963 LinkDB All DBs Position 2170029..2170313 Genome browser AA seq 94 aa AA seqDB search MLKPLGDRIVIEVVETEEKTASGIVLPDTAKEKPQEGRVVAVGAGRVLDNGQRVAPEVEV GDRIIFSKYAGTEVKYDGKEYLILRESDVLAVIR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgttgaagccattaggcgatcgcattgtcattgaagtcgtggaaactgaagaaaaaacg gctagcggcatcgtgctgccggatacggcgaaagaaaagccgcaagaaggccgtgttgtc gctgtcggtgcaggccgcgtgcttgacaacggccaacgcgttgcgccggaagttgaagtc ggcgaccgcatcattttctcgaaatacgccggcacggaagtaaaatacgacggaaaagaa tacttaattttgcgcgaaagcgatgttttggctgtcatccgctaa

DBGET integrated database retrieval system