Geobacillus sp. LC300: IB49_16185 Help Entry IB49_16185        CDS       T04018                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gel  Geobacillus sp. LC300 Pathway gel01100   Metabolic pathways gel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IB49_16185    00074 Mycolic acid biosynthesis     IB49_16185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IB49_16185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  AKU27673 LinkDB All DBs Position 3052048..3052281 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtattggaacgtgtcacgaaaatcatcgtcgaccggctcggggttgacgaa tcgcaagtgacgctcgaggcgtcgttcaaagacgatttgggtgctgactcgctcgacatc gtcgaattggtcatggagctcgaagacgaattcaacatggaaatttccgacgaagaagcg gaaaaaattgtcacagtcggagatgctgtgaactacataaaaagccatctgtaa

DBGET integrated database retrieval system