Geobacter sp. M21: GM21_1157 Help Entry GM21_1157         CDS       T00933                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gem  Geobacter sp. M21 Pathway gem01100   Metabolic pathways gem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GM21_1157    00074 Mycolic acid biosynthesis     GM21_1157   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GM21_1157 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ACT17218 UniProt:  C6E345 LinkDB All DBs Position 1346054..1346287 Genome browser AA seq 77 aa AA seqDB search MASIEKRIKEIVAEQLGVDEAQVTNESSFMDDLGADSLDTVELVMALEEEFEIEISDEDA EKIQSVQDAIDYITDHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttcgatcgaaaaacgcattaaagaaatagttgccgagcagcttggtgtagacgag gctcaggtgaccaatgagtcttccttcatggatgacctcggcgccgactcgctggatacc gtggaactggtaatggccctcgaagaagagttcgaaatcgaaatctccgacgaagacgcc gaaaaaatccagtccgtccaggacgcaattgactacatcaccgatcacacctag

DBGET integrated database retrieval system