Geotalea daltonii: Geob_1905 Help Entry Geob_1905         CDS       T00846                                  Symbol acpP-1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism geo  Geotalea daltonii Pathway geo01100   Metabolic pathways geo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:geo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Geob_1905 (acpP-1)    00074 Mycolic acid biosynthesis     Geob_1905 (acpP-1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Geob_1905 (acpP-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ACM20262 UniProt:  B9M7H4 LinkDB All DBs Position 2133281..2133538 Genome browser AA seq 85 aa AA seqDB search MSEELIDQVKQLIIDSLRIEGMGISDIETDAPLFGEGLGLDSIDALQLVVGMEKAFGVVV PDAETGNKVFRSVRTMAEFIAEHRK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcagaagaattgatcgaccaagtgaaacaactgattatagacagcctccgcatcgag gggatggggatcagcgacatcgagacggacgctcccctgtttggcgaagggttggggctc gactccatcgacgctctgcaactggtggtagggatggaaaaggcattcggcgttgtcgtc cctgatgcagagaccggcaacaaggttttccgctccgtcaggaccatggcagaattcatc gcggaacaccgtaaatga

DBGET integrated database retrieval system