Geothrix sp. PMB-07: Q9293_07525
Help
Entry
Q9293_07525 CDS
T09655
Symbol
proS
Name
(GenBank) proline--tRNA ligase
KO
K01881
prolyl-tRNA synthetase [EC:
6.1.1.15
]
Organism
gep
Geothrix sp. PMB-07
Pathway
gep00970
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:
gep00001
]
09120 Genetic Information Processing
09122 Translation
00970 Aminoacyl-tRNA biosynthesis
Q9293_07525 (proS)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
gep01007
]
Q9293_07525 (proS)
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
gep03016
]
Q9293_07525 (proS)
Enzymes [BR:
gep01000
]
6. Ligases
6.1 Forming carbon-oxygen bonds
6.1.1 Ligases forming aminoacyl-tRNA and related compounds
6.1.1.15 proline---tRNA ligase
Q9293_07525 (proS)
Amino acid related enzymes [BR:
gep01007
]
Aminoacyl-tRNA synthetase
Class II (C/G)
Q9293_07525 (proS)
Transfer RNA biogenesis [BR:
gep03016
]
Eukaryotic type
Aminoacyl-tRNA synthetases (AARSs)
Multi-aminoacyl-tRNA synthetase complex (MSC)
Q9293_07525 (proS)
Prokaryotic type
Q9293_07525 (proS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
tRNA-synt_2b
HGTP_anticodon
tRNA_edit
zf-C2H2_ZFHX3
Motif
Other DBs
NCBI-ProteinID:
WLT33172
LinkDB
All DBs
Position
1691290..1693128
Genome browser
AA seq
612 aa
AA seq
DB search
MKQSKLLIQTLRETPRDADVVSQQLMMRAGMIQKVAAGIYSYLPLAFRSIRKFEEIVREE
LAKDGCQELTMPAVLPAELWQESGRWKFYGDELLRFCDRKAKAEVAERRARGEKPDEREF
YNFCLGPTHEEVITDIVRKNVRSYKQLPMNLFQIQTKFRDERRPRFGLMRGREFTMKDGY
SFHADDACADREYWAMFNAYKRIFARLGVKFRPVEADSGAIGGSFTHEFHVLAGSGEDAI
LSCNACDYTSNIEKTEAPALPAGDHGAAFELKRDHFCTPGVLGQVEQAAGMKDAEHDGMP
LAQTSKFFLYRVTFADGATKLVGAVLRGDHEVNPVKVKNHVGAAEMELMPLEEAEAFTGA
KTGFMGPVGLKDVQMLVDASLKGAVNLTCGANRTDYHHFGLDPARDLPGCAYVDLRTASE
GDACTRCGKGSYQAFRGIEVGQVFKLGLKYSKSMSCTFLDEQGKENPMVMGCYGIGITRT
VAAAVEQNYDADGIIWPWPIAPYQVHLVCLDPGSAEVSGVASQVEKDLEAAGFEVLHDDR
EGLSPGAKFKDADLLGFPLRLTVGAKGLKDGIVELRDRRTKDVIKLKPEAAVAEVSTARD
RIMQELETAGGR
NT seq
1839 nt
NT seq
+upstream
nt +downstream
nt
atgaagcaatccaagctcctgatccagaccctgcgcgagacgccgcgcgacgctgacgtg
gtgagtcagcagctcatgatgcgggcgggcatgatccagaaggtggccgccggcatctac
agctacctgcccctggctttccggagcattcgcaaatttgaggaaatcgtccgcgaagag
ctggccaaggatggctgccaggagctgaccatgccagcggtgctgcctgcggagctgtgg
caggagagcggccgctggaagttctacggcgacgagctgctgcgcttctgcgaccgcaag
gccaaggccgaggtggccgagcgccgtgcccggggtgagaagcccgatgagcgtgagttc
tacaacttctgcctgggccccacccacgaggaagtcatcaccgacatcgtccgcaagaac
gtgcgcagctacaaacagctgcccatgaacctgttccagattcagaccaagttccgggat
gagcgccgcccccgcttcggcctcatgcgcggccgtgaattcaccatgaaggacggctac
tccttccacgcggacgatgcctgcgccgaccgtgagtactgggcgatgttcaacgcctac
aagcgcatcttcgcccgccttggggtgaaattccgtccggtggaagccgatagcggcgcc
attggcggcagcttcacccacgagttccacgtgctggctggcagcggcgaagacgccatc
ctcagctgcaatgcctgcgactacacctccaacattgagaagaccgaggcgcccgccttg
cccgcgggcgaccacggagcggcctttgagctgaagcgggaccacttctgcacgccaggg
gtgctgggtcaagtggagcaggctgccggcatgaaggacgccgagcacgacggcatgccc
ctggctcagaccagcaagttcttcctgtaccgtgtcacgttcgcggacggcgccaccaag
ctggtgggggccgtgctgcgcggcgatcacgaagttaatcccgtgaaggtgaaaaaccac
gtaggcgccgccgaaatggagctcatgcccctggaggaagccgaggccttcaccggcgcc
aagaccggcttcatggggccggtgggcctgaaggacgtgcagatgctggtggacgccagc
ctcaagggcgcggtgaacctcacctgcggcgcgaaccggacggactaccaccactttggc
ctggatcccgcccgcgacctgccgggttgcgcctacgtcgacttgcgcaccgcctccgag
ggcgatgcctgcacccgctgcgggaagggcagctaccaggcattccggggcatcgaggtg
gggcaggtcttcaagctgggcctgaagtattccaaatccatgtcctgcaccttcctcgac
gagcagggcaaagagaatcccatggtcatgggctgctacggcatcggcatcacccgcacg
gtggccgcggctgtcgagcagaactacgatgctgacggcatcatctggccctggcccatc
gcgccttaccaggtgcacctggtctgcctggatccgggcagcgccgaggtgtctggcgtg
gccagccaggtggagaaggatctggaagccgccggtttcgaggtgctgcatgacgatcgc
gagggcctgagcccgggcgccaagttcaaggacgccgacctgctgggcttccccctgcgc
ctcaccgtgggcgccaagggcctgaaggatggcatcgtggaactgcgggatcgccgcacc
aaggacgtgatcaagctcaagcccgaggccgctgtggcagaagtctccacggcccgggac
cgcatcatgcaggaactggaaaccgcaggaggccgctga
DBGET
integrated database retrieval system