KEGG   Geothrix sp. PMB-07: Q9293_11010
Entry
Q9293_11010       CDS       T09655                                 
Name
(GenBank) alpha/beta hydrolase
  KO
K01055  3-oxoadipate enol-lactonase [EC:3.1.1.24]
Organism
gep  Geothrix sp. PMB-07
Pathway
gep00362  Benzoate degradation
gep01100  Metabolic pathways
gep01120  Microbial metabolism in diverse environments
gep01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gep00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q9293_11010
Enzymes [BR:gep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     Q9293_11010
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4
Other DBs
NCBI-ProteinID: WLT30247
LinkDB
Position
complement(2478120..2478953)
AA seq 277 aa
MRAQPTFATLASGVKLHYRVQGNPEGPWMVLLNGLLSDTTMWAGVLPGLTDHFRVLTFDS
RGQGRSDAPLEGPYATALLAEEAWELFQVLGVVRPWLVGLSNGSAMSLELLSGRPDAFAG
AVLTSAMPCFDFALNLKAEHWAHCLEVGGPLMQFDAVAPFLWGDSFLEARHGVLRAYHQV
VTGADRPQHGNLHQIRGTKGWDIRDRLGRIEAPLLLLCGAEDLLTPPWKCLETARRISHS
RFEVIQGIGHAFPVEAPKRFVARVREFISEAAPGFGR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcgtgcccagcccaccttcgccacgctggcctccggcgtcaaactgcactaccgcgtt
cagggcaaccccgaaggcccctggatggtgctgctcaacggcctgctttccgataccacc
atgtgggcgggcgttctgccgggcctcacggatcacttccgcgtgctcaccttcgacagc
cggggccagggccgctcggatgcgcccctggaagggccctatgccacagcgctcctggcc
gaggaggcttgggagctgttccaagtcctgggcgtggtgaggccatggctcgtgggcctt
tccaacggcagcgccatgagcctggagctgctgagcggacgtccggatgccttcgcgggc
gccgtgctcaccagtgccatgccctgctttgatttcgccctgaatctcaaggccgaacac
tgggcccactgcctggaggtgggagggcctctcatgcaattcgatgcggtcgcgccgttc
ctctggggcgacagcttcctggaggcgcggcatggcgttctgagggcctaccaccaggtg
gtgacgggggcggatcggccccagcacgggaatctccaccagatcaggggcacgaaggga
tgggacatccgcgaccgcctgggccgcatcgaagcccccctgttgcttctatgcggcgct
gaggacctgctcacccctccctggaagtgcctcgaaacggcacggcggatttctcacagc
cgcttcgaagtgatccagggcatcggccacgctttccccgtggaagcgcccaagcgcttc
gtcgcccgggtgcgcgaattcatatctgaagccgctccgggatttggccgataa

DBGET integrated database retrieval system