Geomonas oryzisoli: KP004_05070 Help Entry KP004_05070       CDS       T07282                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ger  Geomonas oryzisoli Pathway ger01100   Metabolic pathways ger01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ger00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KP004_05070 (acpP)    00074 Mycolic acid biosynthesis     KP004_05070 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KP004_05070 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QWV94561 LinkDB All DBs Position 1139313..1139546 Genome browser AA seq 77 aa AA seqDB search MASIEKRIKEIVAEQLGVDEAQVTNESSFMDDLGADSLDTVELVMALEEEFEIEISDEDA EKIQSVQDAIDYITDHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttcgatcgagaaacgcattaaagagatagtcgctgagcagcttggtgttgacgag gctcaggtgaccaacgagtcctccttcatggacgacctgggtgccgactccctggatacc gtagaactggttatggcccttgaagaggagttcgaaatcgagatctccgacgaggacgcc gagaagatccagtcggtacaggacgcaatcgactacatcactgatcacacctag

DBGET integrated database retrieval system