Geomonas oryzisoli: KP004_05155 Help Entry KP004_05155       CDS       T07282                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ger  Geomonas oryzisoli Pathway ger00020   Citrate cycle (TCA cycle) ger00720   Other carbon fixation pathways ger01100   Metabolic pathways ger01110   Biosynthesis of secondary metabolites ger01120   Microbial metabolism in diverse environments ger01200   Carbon metabolism ger01210   2-Oxocarboxylic acid metabolism Module ger_M00009   Citrate cycle (TCA cycle, Krebs cycle) ger_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ger00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KP004_05155   09102 Energy metabolism    00720 Other carbon fixation pathways     KP004_05155 Enzymes [BR:ger01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KP004_05155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_6 Fer4_21 Fer4_15 LdpA_Fe-S-bd Fer4_4 Fer4_8 Fer4_16 Fer4_3 Fer4_13 Fer4_17 Fer4_22 HTH_38 Motif Other DBs NCBI-ProteinID:  QWV94577 UniProt:  A0ABX8JB09 LinkDB All DBs Position 1161263..1161466 Genome browser AA seq 67 aa AA seqDB search MGRIVIDEMRCKGCGICTIACPKKLIRLCEKVNIQGYAPAEAPDLEQCTGCALCAEICPD VAITVFK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggggagaattgtaatagacgaaatgcgctgcaagggttgcggtatctgcaccattgct tgcccaaagaagctgatcaggctgtgcgaaaaggtcaatatccagggatatgcacctgct gaggctcccgatctggagcagtgcaccgggtgtgctctctgcgccgaaatctgtccggac gttgccatcactgtcttcaaatag

DBGET integrated database retrieval system