KEGG   Geomonas oryzisoli: KP004_16870
Entry
KP004_16870       CDS       T07282                                 
Symbol
gpmA
Name
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ger  Geomonas oryzisoli
Pathway
ger00010  Glycolysis / Gluconeogenesis
ger00260  Glycine, serine and threonine metabolism
ger00680  Methane metabolism
ger01100  Metabolic pathways
ger01110  Biosynthesis of secondary metabolites
ger01120  Microbial metabolism in diverse environments
ger01200  Carbon metabolism
ger01230  Biosynthesis of amino acids
Module
ger_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ger_M00002  Glycolysis, core module involving three-carbon compounds
ger_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ger00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP004_16870 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    KP004_16870 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KP004_16870 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ger04131]
    KP004_16870 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ger04147]
    KP004_16870 (gpmA)
Enzymes [BR:ger01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KP004_16870 (gpmA)
Membrane trafficking [BR:ger04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KP004_16870 (gpmA)
Exosome [BR:ger04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KP004_16870 (gpmA)
  Exosomal proteins of melanoma cells
   KP004_16870 (gpmA)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: QWV92828
UniProt: A0ABX8J359
LinkDB
Position
3880277..3880984
AA seq 235 aa
MQQLVLVRHGESVWNQENLFTGWTDVELSPHGEEESRNAGRLLREKGFVFDVAFTSVLRR
AIGTLWLILREMDLMWIEECKDWRLNERHYGALQGLNKAQTAEKYGEEQVKLWRRSYHVR
PPALAEGDQRHPGRDLRYASLPPHLIPRTECLQDTVERVLPCWQQVIVPALRECRRPLIV
AHGNSLRGLIKYLDRVSDSDIVNLEIPTGTPLVYELDDNLKPIRHYYASEIGTPA
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcagcaactggtactggtccgacatggcgagagcgtctggaatcaggaaaacctgttc
accggctggaccgacgtggaactgtcaccgcacggtgaggaggaaagcaggaacgcggga
aggcttttgagggagaaaggtttcgtcttcgacgtcgccttcacctcggtgctgcgccgg
gccatcgggacgctctggctcatcctgcgcgagatggatctgatgtggatcgaggagtgc
aaggactggcgcctcaacgagagacactacggcgctctgcagggattgaacaaggcccag
accgccgagaagtacggggaggagcaggtgaagctgtggcggcgcagctaccacgtgcgg
ccgcccgcgctcgccgagggggaccagcgccaccccggccgggatctgcgctacgcgtca
ctgccgccgcatctcatcccacggaccgaatgcctgcaggacacggtggagcgggtgctt
ccgtgctggcagcaggtcatcgtcccggccctgcgggaatgccgccgcccgctcatcgtc
gcccacggcaacagcttgcgcggcctcatcaagtacctggaccgggtctccgactcggac
atcgtcaacctcgagatccctaccggaaccccgctggtgtatgaactggacgacaacctc
aaaccgatccggcactactacgcctccgagatcggcactcccgcctag

DBGET integrated database retrieval system