Gemmata sp. SH-PL17: VT84_35620 Help Entry VT84_35620        CDS       T04358                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism ges  Gemmata sp. SH-PL17 Pathway ges02020   Two-component system ges02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ges00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VT84_35620  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     VT84_35620  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ges02035]     VT84_35620 Bacterial motility proteins [BR:ges02035]  Flagellar system   Flagellar assembly proteins    Others     VT84_35620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AMV29777 UniProt:  A0A142XS40 LinkDB All DBs Position 8294240..8294518 Genome browser AA seq 92 aa AA seqDB search MRETSPRGWHRWRVAVVKSAPLGSPFDRMMRRSSAPVAAPEPVRNPEPKSPDGIRHELVA RVRQQIADGTYDTEEKWLLAEEALIRRIADRA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcgagacctcaccacgtggctggcaccgctggcgcgtcgccgtcgtcaagtccgca ccgctgggttcgcccttcgatcgaatgatgcgccgatccagcgcaccggtcgcggcgccc gaaccggtacggaacccggaaccgaaatcaccggacggtatccgtcacgaactcgtggcc cgcgtgcgccagcaaattgcggacggcacttacgacaccgaggaaaagtggctcctcgcg gaagaggcactgatccgccggatcgcggaccgggcgtaa

DBGET integrated database retrieval system