Geothrix sp. L227-G1: QOZ81_001454 Help Entry QOZ81_001454      CDS       T09988                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism get  Geothrix sp. L227-G1 Pathway get01100   Metabolic pathways get01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:get00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QOZ81_001454 (acpP)    00074 Mycolic acid biosynthesis     QOZ81_001454 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QOZ81_001454 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WIL22164 LinkDB All DBs Position 1610140..1610379 Genome browser AA seq 79 aa AA seqDB search MADVRKKVIAIIAEQLAKPEDSISESSHFVDDLGADSLDTVEIIMAIEEAFSLEIPESEQ EKIRTVGDAISYIEKHAKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggctgatgtgcgcaagaaggtcattgctattatcgctgagcagctggccaagcccgaa gattccatttccgaatccagccacttcgtggacgatctcggcgccgacagtctcgatacc gtcgagatcatcatggcgatcgaggaggccttcagcctcgagatccccgagagcgagcag gagaagatccgcaccgtgggcgatgcgatctcctacatcgagaagcacgcgaaggcttga

DBGET integrated database retrieval system