Geothrix sp. L227-G1: QOZ81_001702 Help Entry QOZ81_001702      CDS       T09988                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism get  Geothrix sp. L227-G1 Brite KEGG Orthology (KO) [BR:get00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:get03032]     QOZ81_001702    03036 Chromosome and associated proteins [BR:get03036]     QOZ81_001702    03400 DNA repair and recombination proteins [BR:get03400]     QOZ81_001702 DNA replication proteins [BR:get03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QOZ81_001702 Chromosome and associated proteins [BR:get03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QOZ81_001702 DNA repair and recombination proteins [BR:get03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QOZ81_001702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  WIL19201 LinkDB All DBs Position 1874243..1874554 Genome browser AA seq 103 aa AA seqDB search MAENLTKAELVEAVAKAADITKSAAAAAIGCFLGTISGHVGKGGKVTLVGFGTFSQKVRK ARTGRNPQTGAAIKIGASKSMGFKASKAGAAKKAAPKKAAKKK NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggccgagaacctcaccaaggctgaactcgtcgaagccgtcgccaaggctgccgacatc accaagtccgccgccgccgctgcgatcggctgcttcctcggaaccatctccggccacgtc ggcaagggcgggaaggtgaccctggtcggcttcggcaccttctcccagaaggtccgcaag gcccgcaccggccgcaacccccagactggcgccgcgatcaagatcggcgcttccaagtcc atgggcttcaaggcctccaaggccggcgccgcgaagaaggccgcccccaagaaggctgcc aagaagaagtag

DBGET integrated database retrieval system