Geobacter sp. SVR: GSVR_07210 Help Entry GSVR_07210        CDS       T10318                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gev  Geobacter sp. SVR Pathway gev01100   Metabolic pathways gev01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gev00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GSVR_07210    00074 Mycolic acid biosynthesis     GSVR_07210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GSVR_07210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCS52413 LinkDB All DBs Position complement(761654..761890) Genome browser AA seq 78 aa AA seqDB search MVTLDMLDPIFREVFDDTAITLQRGTTADDIEAWDSLTHMNLVIALELAFKVKFALGELQ QLKNVGDMLDLINKKLAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggtgaccctggacatgctggaccccatattccgtgaagtcttcgacgacaccgccata accctgcaacgcggcaccacggctgatgacatcgaggcctgggactccctgacccatatg aacctggtaattgcccttgaactcgcattcaaggtcaagtttgccctgggtgaactgcaa cagttgaaaaacgtcggtgacatgctggacctgatcaacaagaaattggctaaataa

DBGET integrated database retrieval system