Geobacter sp. SVR: GSVR_33090 Help Entry GSVR_33090        CDS       T10318                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism gev  Geobacter sp. SVR Pathway gev01100   Metabolic pathways gev01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gev00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GSVR_33090    00074 Mycolic acid biosynthesis     GSVR_33090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GSVR_33090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Mycobacteriophage_Gene3 Motif Other DBs NCBI-ProteinID:  BCS55001 LinkDB All DBs Position 3530908..3531150 Genome browser AA seq 80 aa AA seqDB search MQRNQIEQAVLNVLEAFLKCQLKLGDEISRQNTADWDSLKHMEIMFALEEELGVEFSEEE LAKLDSAVKIVDAVLAKHAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcagcgcaatcagattgaacaagcagtgttgaacgtacttgaagcgtttctcaagtgc cagctaaagttaggtgacgaaatttctcgccagaatactgccgattgggactcgctgaag cacatggaaattatgtttgctctcgaagaagaattgggtgttgaattttcagaagaagaa ttggccaagcttgacagtgcggtcaagattgttgacgcggtgctggccaaacatgcggca taa

DBGET integrated database retrieval system